PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 88aa    MW: 10126.9 Da    PI: 10.3568
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436629.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ ++ + G g+W++ +++  + R++k+c++rw +yl
   XP_016436629.1 14 KGPWTPEEDRKLLSCIVENGCGSWRALPAKADLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129422.006965IPR017930Myb domain
SMARTSM007172.2E-91363IPR001005SANT/Myb domain
PfamPF002492.0E-141461IPR001005SANT/Myb domain
SuperFamilySSF466891.21E-211588IPR009057Homeodomain-like
CDDcd001672.56E-81661No hitNo description
Gene3DG3DSA:1.10.10.604.4E-86588IPR009057Homeodomain-like
PROSITE profilePS512947.3776688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRSKCCDKQ GLKKGPWTPE EDRKLLSCIV ENGCGSWRAL PAKADLQRCG KSCRLRWINY  60
LRPDIKRGKF SLQEERTIIQ LHALLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-171288580B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436629.14e-59PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-42MYB4_ORYSJ; Myb-related protein Myb4
SwissprotQ8GWP08e-42MYB39_ARATH; Transcription factor MYB39
TrEMBLG3FSI37e-51G3FSI3_LOTJA; MIXTA-like transcription factor
TrEMBLG7KKX76e-51G7KKX7_MEDTR; Myb transcription factor mixta-like protein
STRINGGLYMA09G37040.22e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.22e-50myb domain protein 16